| Bioactivity | Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM[1]. | ||||||
| Sequence | Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu | ||||||
| Shortening | GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE | ||||||
| Formula | C156H250N36O47.xC2HF3O2 | ||||||
| Molar Mass | 3381.87 (free base) | ||||||
| Appearance | 固体 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Naoki Saigo, et al. Electrophysiological Analysis of Antimicrobial Peptides in Diverse Species. ACS Omega. 2019 Aug 6;4(8):13124-13130. |