PeptideDB

Pardaxin P5 TFA

CAS: F: C156H250N36O47.xC2HF3O2 W: 3381.87 (free base)

Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibit
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pardaxin P5 TFA is the TFA salt form of Pardaxin P5 (HY-P5803). Pardaxin P5 TFA is an antimicrobial peptide that inhibits Escherichia coli with a MIC value of 13 μM[1].
Sequence Gly-Phe-Phe-Ala-Leu-Ile-Pro-Lys-Ile-Ile-Ser-Ser-Pro-Leu-Phe-Lys-Thr-Leu-Leu-Ser-Ala-Val-Gly-Ser-Ala-Leu-Ser-Ser-Ser-Gly-Asp-Gln-Glu
Shortening GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
Formula C156H250N36O47.xC2HF3O2
Molar Mass 3381.87 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

Reference [1]. Naoki Saigo, et al. Electrophysiological Analysis of Antimicrobial Peptides in Diverse Species. ACS Omega. 2019 Aug 6;4(8):13124-13130.