| Bioactivity | Parathyroid hormone (1-34) (rat) (acetate) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis[1][2]. | ||||||
| Name | Parathyroid hormone (1-34) (rat) acetate | ||||||
| Sequence | Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe | ||||||
| Shortening | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF | ||||||
| Formula | C182H295N55O50S2 | ||||||
| Molar Mass | 4117.76 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |