Bioactivity | Parathyroid Hormone (1-34), bovine TFA is a potent parathyroid hormone (PTH) receptor agonist. Parathyroid Hormone (1-34), bovine increases calcium and inorganic phosphate levels in vivo. Parathyroid Hormone (1-34), bovine can be used for th reseach of osteoporosis[1]. |
Invitro | Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) are added to the medium, it inhibits osteoblast proliferation in a dose-dependent manner. In another group, bPTH are added to the culture medium from day 1 to day 10, but not from days 11 to 20, a rebound of proliferation is observed in the PTH Day 1–10 group after bPTH withdrawal[1].Parathyroid Hormone (1-34), bovine (0.1-100 ng/mL; 2-20 days) induces diverse effects on the calcium and phosphorus content of culture medium. The calcium and phosphorus content of culture medium in the PTH-C 100 ng/mL group are higher than in the control group[1]. |
In Vivo | Parathyroid Hormone (1-34)(subcutaneous injection; 80 μg/kg; 5 days) increases serum osteocalcin concentrations without changing serum inorganic phosphate or calcium concentrations in either group of old animals. Serum 1,25-dihydroxyvitamin D concentrations are significantly higher in the PTH-treated senile female rats than the sex-matchedvehicle-treated controls[1]. |
Name | Parathyroid Hormone (1-34), bovine TFA |
Shortening | AVSEIQFMHNGKHLSSMERVEWLRKKLQDVHNF |
Formula | C185H289F3N54O52S2 |
Molar Mass | 4222.79 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. B H Mitlak, et al. Intermittent administration of bovine PTH-(1-34) increases serum 1,25-dihydroxyvitamin D concentrations and spinal bone density in senile (23 month) rats. J Bone Miner Res. 1992 May;7(5):479-84. [2]. M Takigawa, et al. Studies on chondrocytes from mandibular condylar cartilage, nasal septal cartilage, and spheno-occipital synchondrosis in culture. I. Morphology, growth, glycosaminoglycan synthesis, and responsiveness to bovine parathyroid hormone (1-3 |