| Bioactivity | Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel[1]. |
| Name | Pandinotoxin Kα |
| CAS | 185529-64-0 |
| Sequence | Thr-Ile-Ser-Cys-Thr-Asn-Pro-Lys-Gln-Cys-Tyr-Pro-His-Cys-Lys-Lys-Glu-Thr-Gly-Tyr-Pro-Asn-Ala-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Phe-Gly-Arg (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32) |
| Shortening | TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32) |
| Formula | C169H267N53O48S7 |
| Molar Mass | 4033.71 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. T C Tenenholz, et al. Solution Structure for Pandinus Toxin K-α (PiTX-Kα), a Selective Blocker of A-Type Potassium Channels. Biochemistry. 1997 Mar 11;36(10):2763-71. [2]. Targeting Kai-Zheng Duan, et al. A-type K(+) channels in primary sensory neurons for bone cancer pain in a rat model. Pain.2012 Mar;153(3):562-574. |
Pandinotoxin Kα
CAS: 185529-64-0 F: C169H267N53O48S7 W: 4033.71
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.