PeptideDB

Pandinotoxin Kα

CAS: 185529-64-0 F: C169H267N53O48S7 W: 4033.71

Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel[1].
Name Pandinotoxin Kα
CAS 185529-64-0
Sequence Thr-Ile-Ser-Cys-Thr-Asn-Pro-Lys-Gln-Cys-Tyr-Pro-His-Cys-Lys-Lys-Glu-Thr-Gly-Tyr-Pro-Asn-Ala-Lys-Cys-Met-Asn-Arg-Lys-Cys-Lys-Cys-Phe-Gly-Arg (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32)
Shortening TISCTNPKQCYPHCKKETGYPNAKCMNRKCKCFGR (Disulfide bridge: Cys4-Cys25,Cys10-Cys30,Cys14-Cys32)
Formula C169H267N53O48S7
Molar Mass 4033.71
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. T C Tenenholz, et al. Solution Structure for Pandinus Toxin K-α (PiTX-Kα), a Selective Blocker of A-Type Potassium Channels. Biochemistry. 1997 Mar 11;36(10):2763-71. [2]. Targeting Kai-Zheng Duan, et al. A-type K(+) channels in primary sensory neurons for bone cancer pain in a rat model. Pain.2012 Mar;153(3):562-574.