| Bioactivity | Pancreastatin (swine) is a 49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swine) can be isolated and characterized from porcine pancreas[1]. |
| Name | Pancreastatin (swine) |
| CAS | 106477-83-2 |
| Shortening | GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG-NH2 |
| Formula | C214H330N68O76S |
| Molar Mass | 5103.37 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Pancreastatin (swine)
CAS: 106477-83-2 F: C214H330N68O76S W: 5103.37
Pancreastatin (swine) is a49-residue peptide which strongly inhibits glucose-induced insulin release. Pancreastatin (swi
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.