| Bioactivity | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance[1]. |
| Name | PMAP-36 |
| CAS | 154338-08-6 |
| Sequence | Gly-Arg-Phe-Arg-Arg-Leu-Arg-Lys-Lys-Thr-Arg-Lys-Arg-Leu-Lys-Lys-Ile-Gly-Lys-Val-Leu-Lys-Trp-Ile-Pro-Pro-Ile-Val-Gly-Ser-Ile-Pro-Leu-Gly-Cys-Gly |
| Shortening | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG |
| Formula | C191H336N62O39S |
| Molar Mass | 4157.17 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yan X, et al. The cathelicidin-like peptide derived from panda genome is a potential antimicrobial peptide [J]. Gene, 2012, 492(2): 368-374. |
PMAP-36
CAS: 154338-08-6 F: C191H336N62O39S W: 4157.17
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional ant
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.