| Bioactivity | PHI-27 (rat) is a 27 amino acid peptide.PHI-27 (rat) is used to find peptide hormones and other active peptides[1]. |
| Name | PHI-27 (rat) |
| CAS | 96849-38-6 |
| Shortening | HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
| Formula | C136H216N36O41 |
| Molar Mass | 3011.44 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |