| Bioactivity | PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides[1]. |
| Name | PHI-27 (porcine) |
| CAS | 80458-29-3 |
| Shortening | HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
| Formula | C136H216N36O40 |
| Molar Mass | 2995.39 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Tatemoto K, et, al. Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6603-7. |
PHI-27 (porcine)
CAS: 80458-29-3 F: C136H216N36O40 W: 2995.39
PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.