PACAP (1-38), human, ovine, rat TFA_product_DataBase

CAS: F: C203H331N63O53S.C2HF3O2 W: 4648.28

PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I re

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity	PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
Name	PACAP (1-38), human, ovine, rat TFA
Sequence	His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Shortening	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Formula	C203H331N63O53S.C2HF3O2
Molar Mass	4648.28
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.

PeptideDB