PeptideDB

Oxyntomodulin (swine)

CAS: 74870-06-7 F: C192H295N59O60S W: 4421.82

Oxyntomodulin (swine) is a dual agonist for GLP-1 receptor (GLP-1R) and glucagon receptor (GCGR), a peptide hormone rele
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Oxyntomodulin (swine) is a dual agonist for GLP-1 receptor (GLP-1R) and glucagon receptor (GCGR), a peptide hormone released from the gut in post-prandial state. Oxyntomodulin (swine) suppresses appetite and reduces food intake[1][2][3].
Invitro Oxyntomodulin (0-1000 nM; 24 or 48 h) promotes neural cell proliferation in a dose- and time-dependent manner[3].Oxyntomodulin (0-1000 nM; 24 h) protects against glutamate toxicity and oxidative stress in neuronal cells[3].Oxyntomodulin (100 nM; 24 h) reduces glutamate-mediated neurotoxicity in primary cortical neurons in a dose-dependent manner[3]. Cell Proliferation Assay[3] Cell Line:
In Vivo Oxyntomodulin (intracerebroventricular administration; 20 μg per rat; once) treatment improves locomotor activity in stroke rats, and reduces cerebral infarction[3]. Animal Model:
Name Oxyntomodulin (swine)
CAS 74870-06-7
Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Formula C192H295N59O60S
Molar Mass 4421.82
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Cohen MA, et al. Oxyntomodulin suppresses appetite and reduces food intake in humans. J Clin Endocrinol Metab. 2003 Oct;88(10):4696-701. [2]. Pocai A. Action and therapeutic potential of oxyntomodulin. Mol Metab. 2013 Dec 14;3(3):241-51. [3]. Li Y, et al. Neurotrophic and neuroprotective effects of oxyntomodulin in neuronal cells and a rat model of stroke. Exp Neurol. 2017 Feb;288:104-113.