Bioactivity | Oxyntomodulin (swine) is a dual agonist for GLP-1 receptor (GLP-1R) and glucagon receptor (GCGR), a peptide hormone released from the gut in post-prandial state. Oxyntomodulin (swine) suppresses appetite and reduces food intake[1][2][3]. |
Invitro | Oxyntomodulin (0-1000 nM; 24 or 48 h) promotes neural cell proliferation in a dose- and time-dependent manner[3].Oxyntomodulin (0-1000 nM; 24 h) protects against glutamate toxicity and oxidative stress in neuronal cells[3].Oxyntomodulin (100 nM; 24 h) reduces glutamate-mediated neurotoxicity in primary cortical neurons in a dose-dependent manner[3]. Cell Proliferation Assay[3] Cell Line: |
In Vivo | Oxyntomodulin (intracerebroventricular administration; 20 μg per rat; once) treatment improves locomotor activity in stroke rats, and reduces cerebral infarction[3]. Animal Model: |
Name | Oxyntomodulin (swine) |
CAS | 74870-06-7 |
Shortening | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA |
Formula | C192H295N59O60S |
Molar Mass | 4421.82 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Cohen MA, et al. Oxyntomodulin suppresses appetite and reduces food intake in humans. J Clin Endocrinol Metab. 2003 Oct;88(10):4696-701. [2]. Pocai A. Action and therapeutic potential of oxyntomodulin. Mol Metab. 2013 Dec 14;3(3):241-51. [3]. Li Y, et al. Neurotrophic and neuroprotective effects of oxyntomodulin in neuronal cells and a rat model of stroke. Exp Neurol. 2017 Feb;288:104-113. |