| Bioactivity | Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids. |
| Name | Oxyntomodulin (human, mouse, rat) |
| CAS | 159002-68-3 |
| Sequence | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala |
| Shortening | HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA |
| Formula | C192H295N61O60S |
| Molar Mass | 4449.83 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Holst JJ, et al. Oxyntomodulin: Actions and role in diabetes. Peptides. 2018 Feb;100:48-53. |