PeptideDB

Oxyntomodulin (human, mouse, rat)

CAS: 159002-68-3 F: C192H295N61O60S W: 4449.83

Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mo
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids.
Name Oxyntomodulin (human, mouse, rat)
CAS 159002-68-3
Sequence His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala
Shortening HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA
Formula C192H295N61O60S
Molar Mass 4449.83
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Holst JJ, et al. Oxyntomodulin: Actions and role in diabetes. Peptides. 2018 Feb;100:48-53.