| Bioactivity | OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen[1]. | ||||||
| Name | OVA (241-270) (TFA) | ||||||
| Shortening | SMLVLLPDEVSGLEQLESIINFEKLTEWTS | ||||||
| Formula | C156H247F3N34O53S1 | ||||||
| Molar Mass | 3535.92 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
OVA (241-270) (TFA)
CAS: F: C156H247F3N34O53S1 W: 3535.92
OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antig
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.