| Bioactivity | OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM)[1][2]. |
| Target | EC50: 4.5 nM (Nav1.7) |
| Name | OD1 |
| Sequence | Gly-Val-Arg-Asp-Ala-Tyr-Ile-Ala-Asp-Asp-Lys-Asn-Cys-Val-Tyr-Thr-Cys-Ala-Ser-Asn-Gly-Tyr-Cys-Asn-Thr-Glu-Cys-Thr-Lys-Asn-Gly-Ala-Glu-Ser-Gly-Tyr-Cys-Gln-Trp-Ile-Gly-Arg-Tyr-Gly-Asn-Ala-Cys-Trp-Cys-Ile-Lys-Leu-Pro-Asp-Glu-Val-Pro-Ile-Arg-Ile-Pro-Gly-Lys-Cys-Arg-NH2 (Disulfide bridge: Cys13-Cys64, Cys17-Cys37, Cys23-Cys47, Cys27-Cys49) |
| Shortening | GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR-NH2 (Disulfide bridge: Cys13-Cys64, Cys17-Cys37, Cys23-Cys47, Cys27-Cys49) |
| Formula | C308H466N90O95S8 |
| Molar Mass | 7206.06 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Durek T, et al. Chemical engineering and structural and pharmacological characterization of the α-scorpion toxin OD1. ACS Chem Biol. 2013;8(6):1215-22. [2]. Salvage SC, et al. The β3-subunit modulates the effect of venom peptides ProTx-II and OD1 on NaV 1.7 gating. J Cell Physiol. 2023 Jun;238(6):1354-1367. |