| Bioactivity | Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2[1]. |
| Invitro | Nocistatin (5.0 nmol) significantly improves the nociception (5.0 nmol)-induced impairment of learning and memory without changing motor activity or response to electric shocks[2]. |
| Name | Nocistatin(human) |
| CAS | 212609-11-5 |
| Sequence | Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln |
| Shortening | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
| Formula | C149H238N42O53S3 |
| Molar Mass | 3561.93 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Nocistatin(human)
CAS: 212609-11-5 F: C149H238N42O53S3 W: 3561.93
Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.