| Bioactivity | Nisotirotide (LY-3457263) is a PYY analog agonist studied in type 2 diabetes and obesity[1]. |
| Name | Nisotirostide |
| CAS | 2663844-45-7 |
| Sequence | Chain1:Pro-Lys-Pro-Glu-Lys-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Trp-Gln-Arg-Tyr-Tyr-Ala-Glu-Leu-Arg-His-Tyr-Leu-Asn-Trp-Leu-Thr-Arg-Gln-Arg-Tyr-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3) |
| Shortening | Chain1:PKPEKPGEDASPEEWQRYYAELRHYLNWLTRQRY-NH2; Chain2:Ggu-Ggu-Oaa (Amide bridge:Chain1 Lys5-Chain2 Oaa3) |
| Formula | C230H343N59O65 |
| Molar Mass | 4974.53 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Kloock S, et al. Obesity and its comorbidities, current treatment options and future perspectives: Challenging bariatric surgery? Pharmacol Ther. 2023 Nov;251:108549. |