| Bioactivity | Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) is a biologically active peptide. |
| Name | Neuropeptide Y-Lys(biotinyl) free acid (human, rat) |
| CAS | 1927927-12-5 |
| Sequence | Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-{Lys(Biotinyl)} |
| Shortening | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-{Lys(Biotinyl)} |
| Formula | C205H310N58O61S2 |
| Molar Mass | 4627.14 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Neuropeptide Y-Lys(biotinyl) free acid (human, rat)
CAS: 1927927-12-5 F: C205H310N58O61S2 W: 4627.14
Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) is a biologically active peptide.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.