Neuropeptide Y (2-36) (porcine)_product_DataBase

Bioactivity	Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders[1].
Invitro	The following information is for reference:Neuropeptide Y (2-36) (porcine): PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2Neuropeptide Y (2-36) (human, rat): PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (97.14% homology to porcine).
In Vivo	Neuropeptide Y (2-36) (porcine) (1.23 µg/rat; i.c.v.; single) induces food intake in rats[1]. Animal Model:
Name	Neuropeptide Y (2-36) (porcine)
CAS	102961-52-4
Shortening	PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2
Formula	C181H278N54O55
Molar Mass	4090.47
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Gerald C, et al. A receptor subtype involved in neuropeptide-Y-induced food intake. Nature. 1996 Jul 11;382(6587):168-71.

PeptideDB