| Bioactivity | Neuropeptide Y (2-36) (porcine) is a porcine-derived neuropeptide with 97.14% homology to rat/human origin. Neuropeptide Y (2-36) (porcine) is also a rat neuropeptide receptor agonist, with EC50 values of 1.2, 1.6 and 3.4 nM for receptor of Y5, Y2 and Y1 respectively. Neuropeptide Y (2-36) (porcine) can be used in studies related to obesity and eating disorders[1]. |
| Invitro | The following information is for reference:Neuropeptide Y (2-36) (porcine): PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2Neuropeptide Y (2-36) (human, rat): PSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2 (97.14% homology to porcine). |
| In Vivo | Neuropeptide Y (2-36) (porcine) (1.23 µg/rat; i.c.v.; single) induces food intake in rats[1]. Animal Model: |
| Name | Neuropeptide Y (2-36) (porcine) |
| CAS | 102961-52-4 |
| Shortening | PSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY-NH2 |
| Formula | C181H278N54O55 |
| Molar Mass | 4090.47 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Gerald C, et al. A receptor subtype involved in neuropeptide-Y-induced food intake. Nature. 1996 Jul 11;382(6587):168-71. |