Neuropeptide W-30 (human)_product_DataBase

Bioactivity	Neuropeptide W-30 (human) is an important stress mediator in the central nervous system that modulates the hypothalamus-pituitary-adrenal (HPA) axis and sympathetic outflow. Neuropeptide W-30 (human) is an endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8. Neuropeptide W-30 (human) activates and binds to both GPR7 and GPR8 at similar effective doses[1][2][3].
CAS	383415-80-3
Sequence	Trp-Tyr-Lys-His-Val-Ala-Ser-Pro-Arg-Tyr-His-Thr-Val-Gly-Arg-Ala-Ala-Gly-Leu-Leu-Met-Gly-Leu-Arg-Arg-Ser-Pro-Tyr-Leu-Trp
Shortening	WYKHVASPRYHTVGRAAGLLMGLRRSPYLW
Formula	C165H249N49O37S
Molar Mass	3543.11
Transport	Room temperature in continental US; may vary elsewhere.
Storage	Please store the product under the recommended conditions in the Certificate of Analysis.
Reference	[1]. Makoto Kawasaki, et al. Centrally administered neuropeptide W-30 activates magnocellular neurosecretory cells in the supraoptic and paraventricular nuclei with neurosecretion in rats. J Endocrinol. 2006 Aug;190(2):213-23. [2]. Nan-Shou Yu, et al. Effects of intracerebroventricular administration of neuropeptide W30 on neurons in the hypothalamic paraventricular nucleus in the conscious rat. Neurosci Lett. 2007 Mar 26;415(2):140-5. [3]. Yukio Shimomura, et al. Identification of neuropeptide W as the endogenous ligand for orphan G-protein-coupled receptors GPR7 and GPR8. J Biol Chem. 2002 Sep 27;277(39):35826-32.

PeptideDB