| Bioactivity | Neuromedin S (human) is a neuropeptide that contains 33 amino acids.? Neuromedin S (human)has been identified in the brain as an endogenous ligand for the orphan G-protein coupled receptor (GPCR) FM-4/TGR-1 and acts on the neuromedin U (NMU) receptor 2 (NMUR2) in the regulation of body weight homeostasis[1]. |
| Name | Neuromedin S (human) |
| CAS | 1138204-27-9 |
| Sequence | Ile-Leu-Gln-Arg-Gly-Ser-Gly-Thr-Ala-Ala-Val-Asp-Phe-Thr-Lys-Lys-Asp-His-Thr-Ala-Thr-Trp-Gly-Arg-Pro-Phe-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 |
| Shortening | ILQRGSGTAAVDFTKKDHTATWGRPFFLFRPRN-NH2 |
| Formula | C173H264N52O45 |
| Molar Mass | 3792.27 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Martin R Edelmann , et al. Tritium Labeling of Neuromedin S by Conjugation with [3H] N-Succinimidyl Propionate. ACS Omega. 2023, 8, 2. |
Neuromedin S (human)
CAS: 1138204-27-9 F: C173H264N52O45 W: 3792.27
Neuromedin S (human) is a neuropeptide that contains 33 amino acids.? Neuromedin S (human)has been identified in the bra
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.