| Bioactivity | Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord, and may exhibit activity in stimulating smooth-muscle[1][2]. |
| CAS | 98537-35-0 |
| Sequence | Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2 |
| Shortening | LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2 |
| Formula | C157H243N51O38S |
| Molar Mass | 3484.99 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Minamino N, et al., Neuromedins: novel smooth-muscle stimulating peptides identified in porcine spinal cord. Peptides. 1985;6 Suppl 3:245-8. [2]. Minamino N, et al., Neuromedin B-32 and B-30: two "big" neuromedin B identified in porcine brain and spinal cord. Biochem Biophys Res Commun. 1985 Jul 31;130(2):685-91. |
Neuromedin (B-30)
CAS: 98537-35-0 F: C157H243N51O38S W: 3484.99
Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord, and may exhibit act
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.