PeptideDB

Neuromedin (B-30)

CAS: 98537-35-0 F: C157H243N51O38S W: 3484.99

Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord, and may exhibit act
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord, and may exhibit activity in stimulating smooth-muscle[1][2].
CAS 98537-35-0
Sequence Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2
Shortening LSWDLPEPRSRAGKIRVHPRGNLWATGHFM-NH2
Formula C157H243N51O38S
Molar Mass 3484.99
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Minamino N, et al., Neuromedins: novel smooth-muscle stimulating peptides identified in porcine spinal cord. Peptides. 1985;6 Suppl 3:245-8. [2]. Minamino N, et al., Neuromedin B-32 and B-30: two "big" neuromedin B identified in porcine brain and spinal cord. Biochem Biophys Res Commun. 1985 Jul 31;130(2):685-91.