| Bioactivity | Nesiritide (Brain Natriuretic Peptide-32 human) acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd values of 7.3 and 13 pM for NPR-A and NPR-C, respectively. Nesiritide acetate can be used for the research of heart failure[1][2]. |
| CAS | 1684439-46-0 |
| Sequence | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: Cys10-Cys26) |
| Shortening | Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys10-Cys26) |
| Formula | C145H248N50O44S4 |
| Molar Mass | 3524.09 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Koller KJ, et al. Molecular biology of the natriuretic peptides and their receptors. Circulation. 1992 Oct;86(4):1081-8. [2]. Hobbs RE, et al. Therapeutic potential of nesiritide (recombinant b-type natriuretic peptide) in the treatment of heart failure. Expert Opin Investig Drugs. 1999 Jul;8(7):1063-72. |
Nesiritide acetate
CAS: 1684439-46-0 F: C145H248N50O44S4 W: 3524.09
Nesiritide (Brain Natriuretic Peptide-32 human) acetate is an agonist of natriuretic peptide receptors (NPRs), with Kd v
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.