| Bioactivity | Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research[1]. |
| Sequence | Phe-Ala-Glu-Lys-Phe-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Phe-Trp-Asp-Pro-Ala-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Leu-Trp-Asp |
| Shortening | FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD |
| Formula | C217H311N47O56 |
| Molar Mass | 4474.07 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Carlson, et al. "The Peptidisc, a simple method for stabilizing membrane proteins in detergent-free solution." Elife 7 (2018): e34085. |
Nanodisc scaffold peptide
CAS: F: C217H311N47O56 W: 4474.07
Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.