PeptideDB

Nanodisc scaffold peptide

CAS: F: C217H311N47O56 W: 4474.07

Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking
Sales Email:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Nanodisc scaffold peptide (NSPr) is an amphipathic double-helical peptide that stabilizes membrane proteins by mimicking their natural environment, allowing them to remain stable and active in detergent-free aqueous solutions. Nanodisc scaffold peptide can be used to construct a universal tool for high-throughput stabilization of membrane proteins, facilitating modern biological research[1].
Sequence Phe-Ala-Glu-Lys-Phe-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Phe-Trp-Asp-Pro-Ala-Ala-Glu-Lys-Leu-Lys-Glu-Ala-Val-Lys-Asp-Tyr-Phe-Ala-Lys-Leu-Trp-Asp
Shortening FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD
Formula C217H311N47O56
Molar Mass 4474.07
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Carlson, et al. "The Peptidisc, a simple method for stabilizing membrane proteins in detergent-free solution." Elife 7 (2018): e34085.