| Bioactivity | Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has antitumor activity and can be used in therapeutic trials to study cancer, tumors, metastases, radiation oncology, and tumor metastasis[1]. |
| Name | Nagrestipen |
| CAS | 166089-33-4 |
| Shortening | SLAADTPTACCFSYTSRQIPQNFIAAYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA (Disulfide bridge:Cys10-Cys34;Cys11-Cys50) |
| Formula | C338H516N88O108S4 |
| Molar Mass | 7668.48 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Nagrestipen
CAS: 166089-33-4 F: C338H516N88O108S4 W: 7668.48
Nagrestipen, a human macrophage inflammatory protein-1 alpha (MIP-1α) variant, also known as ECI 301. Nagrestipen has a
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.