| Bioactivity | NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1]. | ||||||
| Name | NEP(1-40) | ||||||
| CAS | 475221-20-6 | ||||||
| Sequence | Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2 | ||||||
| Shortening | RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 | ||||||
| Formula | C206H324N56O65 | ||||||
| Molar Mass | 4625.11 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |