| Bioactivity | NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition[1]. |
| Name | NEP(1-40) TFA |
| Sequence | Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2 |
| Shortening | RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2 |
| Formula | C208H325F3N56O67 |
| Molar Mass | 4739.13 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |