PeptideDB

NEP(1-40), N-terminal uncapped

CAS: F: C204H322N56O64 W: 4583.08

NEP(1-40), N-terminal uncapped is a NEP(1-40) (HY-P1242) analog without the acetylation modification at the N-terminal.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity NEP(1-40), N-terminal uncapped is a NEP(1-40) (HY-P1242) analog without the acetylation modification at the N-terminal. NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide[1].
Sequence Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2
Shortening RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Formula C204H322N56O64
Molar Mass 4583.08
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Jenna M Ziebell, et al. Nogo Presence Is Inversely Associated With Shifts in Cortical Microglial Morphology Following Experimental Diffuse Brain Injury. Neuroscience. 2017 Sep 17;359:209-223.