| Bioactivity | Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) is a high-affinity and selective VPAC2 receptor antagonist[1]. |
| Name | Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr free acid |
| CAS | 2243219-86-3 |
| Sequence | {Myr}-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Lys-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Lys-Lys-Gly-Gly-Thr |
| Shortening | {Myr}-HSDAVFTDNYTKLRKQMAVKKYLNSIKKGGT |
| Formula | C171H283N45O47S |
| Molar Mass | 3753.42 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Moreno D, et al. Development of selective agonists and antagonists for the human vasoactive intestinal polypeptide VPAC(2) receptor. Peptides. 2000 Oct;21(10):1543-9. |
Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr free acid
CAS: 2243219-86-3 F: C171H283N45O47S W: 3753.42
Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) is a high-affinity and selective VPAC2 receptor antagonist.
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.