| Bioactivity | Myoregulin (MLN peptide) TFA is a member of the regulin family. Myoregulin TFA regulates muscle performance by modulating intracellular calcium handling. Myoregulin TFA interactes directly with sarcoplasmic reticulum Ca2+-ATPase (SERCA) and impedinf Ca2+ uptake into the sarcoplasmic reticulum[1][2]. |
| Name | Myoregulin TFA |
| Sequence | Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser |
| Shortening | MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS |
| Formula | C239H391N53O67S3.xC2HF3O2 |
| Molar Mass | 5175.17 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Anderson DM, et al. A micropeptide encoded by a putative long noncoding RNA regulates muscle performance. Cell. 2015 Feb 12;160(4):595-606. [2]. Xinqiang Yin, et al. Distribution of micropeptide-coding sORFs in transcripts.Chinese Chemical Letters. Volume 29, Issue 7, July 2018, Pages 1029-1032. |