PeptideDB

Myoregulin TFA

CAS: F: C239H391N53O67S3.xC2HF3O2 W: 5175.17 (free base)

Myoregulin (MLN peptide) TFA is a member of the regulin family. Myoregulin TFA regulates muscle performance by modulatin
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Myoregulin (MLN peptide) TFA is a member of the regulin family. Myoregulin TFA regulates muscle performance by modulating intracellular calcium handling. Myoregulin TFA interactes directly with sarcoplasmic reticulum Ca2+-ATPase (SERCA) and impedinf Ca2+ uptake into the sarcoplasmic reticulum[1][2].
Name Myoregulin TFA
Sequence Met-Ser-Gly-Lys-Ser-Trp-Val-Leu-Ile-Ser-Thr-Thr-Ser-Pro-Gln-Ser-Leu-Glu-Asp-Glu-Ile-Leu-Gly-Arg-Leu-Leu-Lys-Ile-Leu-Phe-Val-Leu-Phe-Val-Asp-Leu-Met-Ser-Ile-Met-Tyr-Val-Val-Ile-Thr-Ser
Shortening MSGKSWVLISTTSPQSLEDEILGRLLKILFVLFVDLMSIMYVVITS
Formula C239H391N53O67S3.xC2HF3O2
Molar Mass 5175.17 (free base)
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Anderson DM, et al. A micropeptide encoded by a putative long noncoding RNA regulates muscle performance. Cell. 2015 Feb 12;160(4):595-606. [2]. Xinqiang Yin, et al. Distribution of micropeptide-coding sORFs in transcripts.Chinese Chemical Letters. Volume 29, Issue 7, July 2018, Pages 1029-1032.