| Bioactivity | Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor[1]. |
| Name | Muscarinic toxin 7 |
| Sequence | Leu-Thr-Cys-Val-Lys-Ser-Asn-Ser-Ile-Trp-Phe-Pro-Thr-Ser-Glu-Asp-Cys-Pro-Asp-Gly-Gln-Asn-Leu-Cys-Phe-Lys-Arg-Trp-Gln-Tyr-Ile-Ser-Pro-Arg-Met-Tyr-Asp-Phe-Thr-Arg-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Lys-Ala-Glu-Tyr-Arg-Asp-Val-Ile-Asn-Cys-Cys-Gly-Thr-Asp-Lys-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63) |
| Shortening | LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK (Disulfide bridge: Cys3-Cys24; Cys17-Cys42; Cys46-Cys57; Cys58-Cys63) |
| Formula | C322H484N90O98S9 |
| Molar Mass | 7472.42 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Olianas MC, et al. Inhibition of acetylcholine muscarinic M(1) receptor function by the M(1)-selective ligand muscarinic toxin 7 (MT-7). Br J Pharmacol. 2000 Oct;131(3):447-52. |