PeptideDB

Mram 8

CAS: 1803183-45-0 F: C132H208N36O39S6 W: 3115.67

Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family[1].
Name Mram 8
CAS 1803183-45-0
Sequence Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Shortening Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27)
Formula C132H208N36O39S6
Molar Mass 3115.67
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. He W, et al. Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides. 2011 Aug;32(8):1719-23.