| Bioactivity | Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family[1]. |
| Name | Mram 8 |
| CAS | 1803183-45-0 |
| Sequence | Cyclo(Ala-Ile-Gly-Cys-Ser-Cys-Lys-Ser-Lys-Val-Cys-Tyr-Arg-Asn-Gly-Ile-Pro-Cys-Gly-Glu-Ser-Cys-Val-Phe-Ile-Pro-Cys-Leu-Thr-Ser) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) |
| Shortening | Cyclo(AIGCSCKSKVCYRNGIPCGESCVFIPCLTS) (Disulfide bridge: Cys4-Cys18,Cys6-Cys22,Cys11-Cys27) |
| Formula | C132H208N36O39S6 |
| Molar Mass | 3115.67 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. He W, et al. Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides. 2011 Aug;32(8):1719-23. |