| Bioactivity | Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into the liver[1]. |
| Name | Met-RANTES (human) |
| CAS | 1883816-50-9 |
| Sequence | Met-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser (Disulfide bridge: Cys11-Cys35, Cys12-Cys51) |
| Shortening | MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS (Disulfide bridge: Cys11-Cys35, Cys12-Cys51) |
| Formula | C355H543N97O101S6 |
| Molar Mass | 7972.90 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Arsiwala T, et al. Kupffer Cells and Blood Monocytes Orchestrate the Clearance of Iron-Carbohydrate Nanoparticles from Serum. Int J Mol Sci. 2022 Feb 28;23(5):2666. |
Met-RANTES (human)
CAS: 1883816-50-9 F: C355H543N97O101S6 W: 7972.90
Met-RANTES (human) is a partial antagonist of CCR5. Met-RANTES (human) reduces the infiltration of blood monocytes into
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.