| Bioactivity | Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA)[1]. |
| Sequence | Met-Ser-Pro-Tyr-Ser-Ser-Asp-Thr-Thr-Pro-Cys-Cys-Phe-Ala-Tyr-Ile-Ala-Arg-Pro-Leu-Pro-Arg-Ala-His-Ile-Lys-Glu-Tyr-Phe-Tyr-Thr-Ser-Gly-Lys-Cys-Ser-Asn-Pro-Ala-Val-Val-Phe-Val-Thr-Arg-Lys-Asn-Arg-Gln-Val-Cys-Ala-Asn-Pro-Glu-Lys-Lys-Trp-Val-Arg-Glu-Tyr-Ile-Asn-Ser-Leu-Glu-Met-Ser (Disulfide bridge: Cys11-Cys35, Cys12-Cys51) |
| Shortening | MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS (Disulfide bridge: Cys11-Cys35, Cys12-Cys51) |
| Formula | C355H543N97O101S6.xC2H4O2 |
| Molar Mass | 7978.07 (free acid) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Shahrara S, et al., Amelioration of rat adjuvant-induced arthritis by Met-RANTES. Arthritis Rheum. 2005 Jun;52(6):1907-19. |
Met-RANTES (human) (acetate)
CAS: F: C355H543N97O101S6.xC2H4O2 W: 7978.07 (free acid)
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antag
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.