| Bioactivity | Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies[1]. |
| Name | Mecasermin |
| CAS | 68562-41-4 |
| Sequence | Gly-Pro-Glu-Thr-Leu-Cys-Gly-Ala-Glu-Leu-Val-Asp-Ala-Leu-Gln-Phe-Val-Cys-Gly-Asp-Arg-Gly-Phe-Tyr-Phe-Asn-Lys-Pro-Thr-Gly-Tyr-Gly-Ser-Ser-Ser-Arg-Arg-Ala-Pro-Gln-Thr-Gly-Ile-Val-Asp-Glu-Cys-Cys-Phe-Arg-Ser-Cys-Asp-Leu-Arg-Arg-Leu-Glu-Met-Tyr-Cys-Ala-Pro-Leu-Lys-Pro-Ala-Lys-Ser-Ala (Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52) |
| Shortening | GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFR (Disulfide bridge:Cys6-Cys48;Cys18-Cys61;Cys47-Cys52) |
| Formula | C331H512N94O101S7 |
| Molar Mass | 7645.68 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Mecasermin
CAS: 68562-41-4 F: C331H512N94O101S7 W: 7645.68
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potenti
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.