| Bioactivity | MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring formation during sporulation[1]. |
| Sequence | Met-Lys-Val-His-Arg-Met-Pro-Lys-Gly-Val-Val-Leu-Val-Gly-Lys-Ala-Trp-Glu-Ile-Arg-Ala-Lys-Leu-Lys-Glu-Tyr-Gly-Arg-Thr-Phe-Gln-Tyr-Val-Lys-Asp-Trp-Ile-Ser-Lys-Pro |
| Shortening | MKVHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP |
| Formula | C222H355N61O52S2 |
| Molar Mass | 4774.70 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Handler AA, et al. Peptide inhibitor of cytokinesis during sporulation in Bacillus subtilis. Mol Microbiol. 2008 May;68(3):588-99. |
MciZ (B. subtilis)
CAS: F: C222H355N61O52S2 W: 4774.70
MciZ (B. subtilis), a 40-amino-acid peptide, inhibits the GTPase activity of FtsZ that prevents inappropriate Z-ring for
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.