| Bioactivity | Maximin 42 is an antimicrobial peptide. Maximin 42 has antibacterial activity against S. aureus (MIC: 37.5 μg/mL). Maximin 42 has hemolytic activities against human red cells[1]. |
| Name | Maximin 42 |
| Sequence | Ser-Ile-Gly-Ala-Lys-Ile-Leu-Gly-Gly-Val-Lys-Thr-Phe-Phe-Lys-Gly-Ala-Leu-Lys-Glu-Leu-Ala-Phe-Thr-Tyr-Leu-Gln-NH2 |
| Shortening | SIGAKILGGVKTFFKGALKELAFTYLQ-NH2 |
| Formula | C139H223N33O34 |
| Molar Mass | 2900.46 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Liu R, et al. There are abundant antimicrobial peptides in brains of two kinds of Bombina toads. J Proteome Res. 2011 Apr 1;10(4):1806-15. |