Bioactivity | Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases[1]. |
Target | ASICs. |
Name | Mambalgin-2 |
Sequence | Leu-Lys-Cys-Phe-Gln-His-Gly-Lys-Val-Val-Thr-Cys-His-Arg-Asp-Met-Lys-Phe-Cys-Tyr-His-Asn-Thr-Gly-Met-Pro-Phe-Arg-Asn-Leu-Lys-Leu-Ile-Leu-Gln-Gly-Cys-Ser-Ser-Ser-Cys-Ser-Glu-Thr-Glu-Asn-Asn-Lys-Cys-Cys-Ser-Thr-Asp-Arg-Cys-Asn-Lys (Disulfide bridge: Cys3-Cys19,Cys41-Cys49,Cys50-Cys55) |
Shortening | LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge: Cys3-Cys19,Cys41-Cys49,Cys50-Cys55) |
Formula | C272H431N85O83S10 |
Molar Mass | 6540.50 |
Transport | Room temperature in continental US; may vary elsewhere. |
Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Reference | [1]. Salinas M, et al. Binding site and inhibitory mechanism of the mambalgin-2 pain-relieving peptide on acid-sensing ion channel 1a. J Biol Chem. 2014 May 9;289(19):13363-73. |