| Bioactivity | Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation[1]. |
| Name | Mambalgin 1 |
| CAS | 1609937-15-6 |
| Shortening | LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK (Disulfide bridge:Cys3-Cys19;Cys12-Cys37;Cys41-Cys49;Cys50-Cys55) |
| Formula | C310H481N87O100S8 |
| Molar Mass | 7283.22 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
Mambalgin 1
CAS: 1609937-15-6 F: C310H481N87O100S8 W: 7283.22
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 ami
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.