| Bioactivity | Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes mellitus (T2DM). | ||||||
| Target | GLP-1 receptor. | ||||||
| Name | Lixisenatide | ||||||
| CAS | 320367-13-3 | ||||||
| Shortening | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 | ||||||
| Formula | C215H347N61O65S | ||||||
| Molar Mass | 4858.49 | ||||||
| Appearance | Solid | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||
| Reference | [1]. Ahrén B et al. Postprandial Glucagon Reductions Correlate to Reductions in Postprandial Glucose and Glycated Hemoglobin with Lixisenatide Treatment in Type 2 Diabetes Mellitus: A Post Hoc Analysis. Diabetes Ther. 2016 Jun 18 [2]. Lorenz M, et al. Effects of lixisenatide once daily on gastric emptying in type 2 diabetes--relationship to postprandial glycemia. Regul Pept. 2013 Aug 10;185:1-8. |
Lixisenatide
CAS: 320367-13-3 F: C215H347N61O65S W: 4858.49
Lixisenatide is a glucagon-like peptide-1 (GLP-1) receptor agonist that can be used in the treatment of type 2 diabetes
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.