PeptideDB

LL-37 scrambled peptide

CAS: F: C205H340N60O53 W: 4493.30

LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can
Sales Email：peptidedb@qq.com
Contact QiTai

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity LL-37 scrambled peptide is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide can be used as a negative control of LL-37 peptide studies.
Name LL-37 scrambled peptide
Shortening GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR
Formula C205H340N60O53
Molar Mass 4493.30
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Microtubule-associated protein tau (26-44)

DL-Threonine methyl ester hydrochloride

Product Recommendation

Latest release

Hot list

Copyright © 2025 PeptideDB All Rights Reserved

Sitemaps | Contact

Is for research use only, not for human use. We do not sell to patients.