PeptideDB

LL-37 amide TFA

CAS: F: C205H341N61O52.xC2HF3O2 W: 4492.28 (free base)

LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used f
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used for cancer research[1][2].
Name LL-37 amide TFA
Sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2
Shortening LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2
Formula C205H341N61O52.xC2HF3O2
Molar Mass 4492.28 (free base)
Appearance 固体
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light)

Reference [1]. Papo N, et al. New lytic peptides based on the D,L-amphipathic helix motif preferentially kill tumor cells compared to normal cells. Biochemistry. 2003;42(31):9346-9354.