| Bioactivity | LL-37-Cys is a LL-37 (HY-P1222) with a C-terminal reduced cystein residue[1][. |
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-Cys |
| Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTESC |
| Formula | C208H345N61O54S |
| Molar Mass | 4596.41 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bowdish DM, et al., Impact of LL-37 on anti-infective immunity. J Leukoc Biol. 2005 Apr;77(4):451-9. |