| Bioactivity | LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing[1][2][3]. | ||||||
| Invitro | LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration[2].LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL[2]. Cell Migration Assay [2] Cell Line: | ||||||
| Name | LL-37, human | ||||||
| CAS | 154947-66-7 | ||||||
| Sequence | Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser | ||||||
| Shortening | [LL-37, 37 aa] | ||||||
| Formula | C205H340N60O53 | ||||||
| Molar Mass | 4493.26 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |