PeptideDB

LL-37, human acetate

CAS: F: C207H344N60O55 W: 4553.31

LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad sp
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing[1][2][3].
Invitro LL-37, human acetate (1-20 μg/mL; 24 h) affects HCECs migration[2].LL-37, human acetate (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].LL-37, human acetate (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2]. Cell Migration Assay [2] Cell Line:
Name LL-37, human acetate
Shortening [LL-37, 37 aa]
Formula C207H344N60O55
Molar Mass 4553.31
Transport Room temperature in continental US; may vary elsewhere.
Storage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)