| Bioactivity | LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human acetate could help protect the cornea from infection and modulates wound healing[1][2][3]. | ||||||
| Invitro | LL-37, human acetate (1-20 μg/mL; 24 h) affects HCECs migration[2].LL-37, human acetate (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].LL-37, human acetate (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg/mL[2]. Cell Migration Assay [2] Cell Line: | ||||||
| Name | LL-37, human acetate | ||||||
| Shortening | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | ||||||
| Formula | C207H344N60O55 | ||||||
| Molar Mass | 4553.31 | ||||||
| Transport | Room temperature in continental US; may vary elsewhere. | ||||||
| Storage | Sealed storage, away from moisture and light, under nitrogen
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen) |
LL-37, human acetate
CAS: F: C207H344N60O55 W: 4553.31
LL-37, human acetate is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad sp
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.