| Bioactivity | Klotho-derived peptide 1 (KP1 human) blocks TGF-β/TGF-β receptor 2 interaction, inhibits TGF-β-induced activation of Smad2/3 and mitogen-activated protein kinase (MAPK), and exhibits anti-fibrotic and kidney protective effects in mouse model[1]. |
| Sequence | Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly |
| Shortening | FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG |
| Formula | C149H203N39O43 |
| Molar Mass | 3228.44 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yuan Q, et al., A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat Commun. 2022 Jan 21;13(1):438. |
Klotho-derived peptide 1
CAS: F: C149H203N39O43 W: 3228.44
Klotho-derived peptide 1 (KP1 human) blocks TGF-β/TGF-β receptor 2 interaction, inhibits TGF-β-induced activation of
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.