| Bioactivity | Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research[1][2]. |
| Name | Kisspeptin-54 (27-54) (human) |
| CAS | 1135442-77-1 |
| Sequence | Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2 |
| Shortening | IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2 |
| Formula | C149H226N42O39 |
| Molar Mass | 3229.65 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Bevec D, et al. Therapeutic uses of urocortin ii and kisspeptin ( 27-54 ). World Intellectual Property Organization. WO2009039984. [2]. Milton N, et al. Kisspeptin peptides for use in the treatment of Alzheimer's disease, Creutzfeldt-Jakob disease or diabetes mellitus. European Patent Organization. EP2388012. |
Kisspeptin-54 (27-54) (human)
CAS: 1135442-77-1 F: C149H226N42O39 W: 3229.65
Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research.
Data collection：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.