PeptideDB

Kisspeptin-54 (27-54) (human)

CAS: 1135442-77-1 F: C149H226N42O39 W: 3229.65

Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research.
Data collection:peptidedb@qq.com

This product is for research use only, not for human use. We do not sell to patients.

Bioactivity Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research[1][2].
Name Kisspeptin-54 (27-54) (human)
CAS 1135442-77-1
Sequence Ile-Pro-Ala-Pro-Gln-Gly-Ala-Val-Leu-Val-Gln-Arg-Glu-Lys-Asp-Leu-Pro-Asn-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH2
Shortening IPAPQGAVLVQREKDLPNYNWNSFGLRF-NH2
Formula C149H226N42O39
Molar Mass 3229.65
Transport Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Reference [1]. Bevec D, et al. Therapeutic uses of urocortin ii and kisspeptin ( 27-54 ). World Intellectual Property Organization. WO2009039984. [2]. Milton N, et al. Kisspeptin peptides for use in the treatment of Alzheimer's disease, Creutzfeldt-Jakob disease or diabetes mellitus. European Patent Organization. EP2388012.