| Bioactivity | KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells[1]. |
| Target | Kv1.1, Kv1.2, Kv1.3 |
| Name | KTX-Sp2 |
| Sequence | Ser-Pro-Leu-His-Gly-Ala-Lys-Cys-Ser-Ser-Ser-Asn-Gln-Cys-Thr-Arg-Pro-Cys-Arg-Tyr-Gly-Gly-Gly-Thr-His-Gly-Lys-Cys-Met-Asn-Gly-Arg-Cys-Arg-Cys-Tyr-Gly (Disulfide bridge: Cys8-Cys28,Cys14-Cys33,Cys18-Cys35) |
| Shortening | SPLHGAKCSSSNQCTRPCRYGGGTHGKCMNGRCRCYG (Disulfide bridge: Cys8-Cys28,Cys14-Cys33,Cys18-Cys35) |
| Formula | C155H244N58O49S7 |
| Molar Mass | 3928.41 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Zhang Y, et al. Immunosuppressive effects of a novel potassium channel toxin Ktx-Sp2 from Scorpiops Pocoki. Cell Biosci. 2019 Dec 16;9:99. |