| Bioactivity | K90-114TAT is an inhibitor for EAG2-Kvβ2 interaction, and exhibits antitumor efficacy against glioblastomas[1]. |
| Sequence | Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Pro-Gln-Gly-Ser-Gly-Ser-Gly-Ser-Tyr-Ala-Ala-Gly-Lys-Ala-Glu-Val-Val-Leu-Gly-Asn-Ile-Ile-Lys-Lys-Lys-Gly-Trp-Arg-Arg-Ser-Ser-Leu-Val |
| Shortening | GRKKRRQRRRPQGSGSGSYAAGKAEVVLGNIIKKKGWRRSSLV |
| Formula | C205H357N77O55 |
| Molar Mass | 4780.51 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yang Y, et al., CNSC-30. IN VIVO DYNAMICS OF ASTROCYTE-GLIOBLASTOMA TUMOR NETWORKS[J]. Neuro-Oncology, 2022, 24 |