| Bioactivity | Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior[1]. |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Glu-Arg-Lys-Cys-Cys-Glu-Gly-Tyr-Val-Cys-Glu-Leu-Trp-Cys-Lys-Tyr-Asn-Leu-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
| Shortening | YCQKWMWTCDSERKCCEGYVCELWCKYNL-NH2 (Disulfide bridge: Cys2-Cys16,Cys9-Cys21,Cys15-Cys25) |
| Formula | C161H227N41O44S7.xC2HF3O2 |
| Molar Mass | 3665.23 (free base) |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Yuan C, et al. Jingzhaotoxin-XII, a gating modifier specific for Kv4.1 channels. Toxicon. 2007 Oct;50(5):646-52. |