| Bioactivity | Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-V inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 nM and 30.2 nM, respectively. Jingzhaotoxin-V also inhibits Kv4.2 potassium currents expressed in Xenpus Laevis oocytes (IC50 of 604.2 nM)[1]. |
| Name | Jingzhaotoxin-V |
| Sequence | Tyr-Cys-Gln-Lys-Trp-Met-Trp-Thr-Cys-Asp-Ser-Lys-Arg-Ala-Cys-Cys-Glu-Gly-Leu-Arg-Cys-Lys-Leu-Trp-Cys-Arg-Lys-Ile-Ile-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
| Shortening | YCQKWMWTCDSKRACCEGLRCKLWCRKII-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys25) |
| Formula | C157H243N47O37S7 |
| Molar Mass | 3605.36 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Xiongzhi Zeng, et al. Isolation and characterization of Jingzhaotoxin-V, a novel neurotoxin from the venom of the spider Chilobrachys jingzhao. Toxicon. 2007 Mar 1;49(3):388-99. |
Jingzhaotoxin-V
CAS: F: C157H243N47O37S7 W: 3605.36
Jingzhaotoxin-V, a 29-residue polypeptide, is derived from the venom of the spider Chilobrachys jingzhao. Jingzhaotoxin-
Sales Email：peptidedb@qq.com
This product is for research use only, not for human use. We do not sell to patients.