| Bioactivity | Jingzhaotoxin-IX, a C-terminally amidated peptide composed of 35 amino acid residues, is a neurotoxin. Jingzhaotoxin-IX inhibits voltage-gated sodium channels (both tetrodotoxin-resistant and tetrodotoxin-sensitive isoforms) and Kv2.1 channel. Jingzhaotoxin-IX has no effect on delayed rectifier potassium channel Kv1.1, 1.2 and 1.3[1]. |
| Name | Jingzhaotoxin-IX |
| Sequence | Glu-Cys-Thr-Lys-Leu-Leu-Gly-Gly-Cys-Thr-Lys-Asp-Ser-Glu-Cys-Cys-Pro-His-Leu-Gly-Cys-Arg-Lys-Lys-Trp-Pro-Tyr-His-Cys-Gly-Trp-Asp-Gly-Thr-Phe-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29) |
| Shortening | ECTKLLGGCTKDSECCPHLGCRKKWPYHCGWDGTF-NH2 (Disulfide bridge:Cys2-Cys16;Cys9-Cys21;Cys15-Cys29) |
| Formula | C171H251N49O48S6 |
| Molar Mass | 3953.51 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Reference | [1]. Meichun Deng, et al. Jingzhaotoxin-IX, a novel gating modifier of both sodium and potassium channels from Chinese tarantula Chilobrachys jingzhao. Neuropharmacology. 2009 Aug;57(2):77-87. |